PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr025728.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NF-YB
Protein Properties Length: 354aa    MW: 38069.5 Da    PI: 5.3883
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr025728.2genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB165.56.8e-52164258195
        NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                  vreqdr++Pianv+rim+++lP +akis+daket+qecvse+i+f+t+ea+++cqre+rkt++++d+lwa+++lGf++yvepl++yl++yre e+
  Pbr025728.2 164 VREQDRYMPIANVIRIMRRILPPHAKISDDAKETMQECVSEYIAFITGEANERCQREQRKTVTAEDVLWAMGKLGFDNYVEPLTIYLQRYRESES 258
                  69******************************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.3E-49161268IPR009072Histone-fold
SuperFamilySSF471131.61E-37167269IPR009072Histone-fold
PfamPF008088.7E-25170234IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006158.4E-16198216No hitNo description
PRINTSPR006158.4E-16217235No hitNo description
PRINTSPR006158.4E-16236254No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MFPAKLAFVT ALSLPIFFNL PVAAEEVTAR NVNPSPTDNC ANCPSCLCPP AVPIPGYPLY  60
GPPPPGPPPP SSPGYPYEGS PPPPPRGQGK CPPTQPSQCC QQYPQNPQYP SPPGGYVPYP  120
DDNHAATNAN SSDGGNAIAN TSNPANSAGN SDNNTEQRAP QCLVREQDRY MPIANVIRIM  180
RRILPPHAKI SDDAKETMQE CVSEYIAFIT GEANERCQRE QRKTVTAEDV LWAMGKLGFD  240
NYVEPLTIYL QRYRESESSD RSRFVKREER QPTDYCPPGH AVPQVAMMSP PPPSYGPGYY  300
FGPQHGPPMC DPSMMGMFRD GSSSGAGGGG SSSASGAQGE NSLGRFDPFG HFK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4csr_A4e-39165255494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B4e-39165255494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4g92_B4e-39164255192Transcription factor HapC (Eurofung)
4g91_B4e-39164255192Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009346554.11e-165PREDICTED: uncharacterized protein LOC103938276
SwissprotQ9SFD89e-59NFYB9_ARATH; Nuclear transcription factor Y subunit B-9
TrEMBLM5WRR41e-78M5WRR4_PRUPE; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27283279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.27e-55nuclear factor Y, subunit B6